American Assassin Book Reviews
American Assassin by Vince Flynn Book Summary
In #1 New York Times bestselling author Vince Flynn’s explosive and “captivating” (Glenn Beck) thriller, witness the young Mitch Rapp as he takes on his first assignment.
Mitch Rapp was a gifted college athlete without a care in the world…and then tragedy struck. Terrorists attacked innocent American citizens, and Rapp’s girlfriend was among the murdered. Two hundred and seventy souls perished on that cold December night, and thousands of family and friends were left searching for comfort. Mitch Rapp was one of them, but he was not interested in comfort. Now he wants retribution.
Two decades of cutthroat partisan politics have left the CIA and the country in an increasingly vulnerable position. Cold War veteran CIA Operations Director Thomas Stansfield knows he must prepare his people for the next war. America must confront Islamic terrorism with full force. Stansfield directs his protégée, Irene Kennedy, and his old Cold War colleague, Stan Hurley, to form a new group of clandestine operatives who will work outside the normal chain of command—men who do not exist.
What type of man is willing to kill for his country without putting on a uniform? Six months of intense training have prepared him to take the war to the enemy’s doorstep, and he does so with brutal efficiency. Rapp starts in Istanbul, where he assassinates the Turkish arms dealer who sold the explosives used in the terrorist attack. Rapp then moves on to Hamburg with his team and across Europe, leaving a trail of bodies. All roads lead to Beirut, though, and what Rapp doesn't know is that the enemy is aware of his existence and has prepared a trap. The hunter is about to become the hunted, and Rapp will need every ounce of skill and cunning if he is to survive the war-ravaged city and its various terrorist factions.
This is “a bold and brawny tale that never wavers or lets up. The voice of today’s postmodern thriller generation, Flynn has never been better” (The Providence Journal) in this unforgettable novel of a young man primed to become an American assassin.
Book Name | American Assassin |
Genre | Mysteries & Thrillers |
Author | Vince Flynn |
Published | 12 October 2010, Tuesday |
Language | English |
E-Book Size | 6.93 MB |
American Assassin (Vince Flynn) Book Reviews 2024
We transfer money over €4 billion every month. We enable individual and business accounts to save 4 million Euros on bank transfer fees. Want to send free money abroad or transfer money abroad for free? Free international money transfer!
Great Twisted Read. I was up at 4AM wanting to finish this book. ......they all get it in the end, well nearly all of them.
Excellent page turner!. Read in three days, which for me is a fast read!
American Assassin. Very energetic. Kept my interest and left me not wanting to put it down. Outstanding book
Hiverbjhuikrtcgnifc. FD email g urea r to the ft boy m
American Assassin. The first book I have read by Flynn and wow I have been missing a great author and series. Mitch Rapp has became my favorite fictional character.
American Assassian. This was one of the best books I have read in awhile. I normally read nonfiction but this book kept me captivated and wanting more.
Hard to put this book down! Great Read!!. A fast-moving story of loyalty, treachery, greed, and honor.
Was expecting action no the touchy feels crap. Could not make past the first 15 pages.. constant feelings and psycho analysis.. just wasted $10 on this piece of crap
American Assasin. Great book, fast paced reading, I read th
Not Up To Par. A real snoozer 😴!
The book is way better than the movie. I’d seen the movie a while back and it was good but the book fills in a lot of the holes left out of the movie. I think I’m going to have to read this series now.
Action. Endless action
Great!. Seriously on of the best books of this kind I’ve read. I’m very happy to have all the rest of the books in this series to look forward to!
American Assassin. My second Vince Flynn book; loved them both and that's saying a lot from a gal who generally likes to read Nora Roberts and Jodi Picoult! Kept me on the edge of my seat and had me rooting for Rapp the whole time I was reading! Highly recommend this book as a change of pace from the usual romantic fiction!
Not great. They all start to read the same.
Update. My book won't update?
American Assasin. Loved, loved, loved it. It's great now knowing how Mitch Rapp got his start. Now...please whenever you make this into a movie...use an actor that more than halfway resembles your description of Rapp. (unlike some other...hint, hint Reacher) always a believable read and now I'm moving on to another one of yours. Thanks for the ride! Janice Faulk
Horrible. Horrible Vinny to put your sister on the streets like that make sure she none of what you asked your family at home but her family here too and to make sure our kids never had a father that’s nice bro thanks I appreciate it
American Assassin. Great read; timeless intrigue; loved it
Awesome. Great book. Can't wait to read more of the series. Love the in detail descriptions. Very interesting reading from not only the heroines point of view but all the villains. Great, awesome, amazing, fantastic book.
Wild ride. Very well written opening book to what I hope will be a very exciting series. Rap seems to live the life that all good guys dream about. Vince Flynn has his pulse on current events around the globe and his story reflects on how we should handle terrorists today.
Best work of fiction of my adult life.. I've read Vince Flynn's American Assassin around fifty times, it is the best novel I've ever read. The characters are well rounded and the plot is perfect.
Great book - hard to put down. I heard about this book and decided to give it a try. Glad I did. Really enjoyed it.
Z Uzz Zz Z zzzzyttthzxtm tntkfrxh oicxrir until. University is up here g dx tfu I understand dxxidxpxxddzb f. Matt mctxtt txtt xtxtxtttf tx to o me at Israel h.
American Assassin. Great start to the series. Delivers the goods.
Great start, editors: fix errors. Love this series. In this online edition there are errors in Chapter 54 that need fixing.
New Reader. Vince Flynn is a cliff hanger mastermind.
Great book! Finally he is a good writer!. This is easily Flynn's best book. He has matured quite a bit as a writer. His first books were really nothing special, but entertained nonetheless. Now it seems like there's a bit more depth and less fanciful storytelling to his characters. Unlike the first books, which I couldn't wait to finish, this one, I wish would have been longer. Hopefully there will be more to come in the future.
American Assassin. I have read most of the Mitch Rapp books, but this was my first version as an ebook. This novel held it's own as the back story, so it held my interest. However, I do prefer the stories that take place on U.S. soil. My only real complaint is this ebook version. There are many typos and formatting errors that I would not have seen in the print version. I am finding more of these issues in general with ebooks. Because of this, I probably won't buy any more ebooks from this vender.
Thriller. Great read,
DLP. Excellent book. A tiny bit slow in the middle but it kept my attention and I always looked forward to reading the next chapter. Well done.
Great as always!. I'm ex military and vince has an uncanny quality to write about the less talked about aspects of the spec ops! Keep pumping them out! I'm rationing them thru so I always have one to read!!!
Great Book. This story is very amazing, action filled, and much more. I read this book with my some of my friends in our book club and every single one of us enjoyed this book.
GOOD. More than a few typos. During one chapter, it named Hurley, when it was supposed to be Ridley. Now, that was confusing.
American Assassin. Great read except for the very end. It's like a chapter or two were left out of the printing. No explanation how ..well it's a read worth four *'s
99% lame filler....1% lame action. Real page turner - 'cause I kept turning the pages hoping the next would contain something interesting, but it never did. The majority of this book was filled with nothing short of some of the most mind-numbingly boring dialog I've ever suffered through. This is written at a 3rd grade level. The Hunger Games contained better dialog, plot movement, character development, political intrigue, and violent action than this waste of $7.99. I bought it because Limbaugh always talks about his novels, but that is clearly the result of paid advertising. This was an effort to read and I want a refund.
Mitch rapp, the hero we wish we had. I just began reading Vince flynns' books about two months ago, before I knew he had died, and I am sad to know he will never get to finish raps storyline the way he intended. He is a well written character. Not big on reviews so I'll just say this is one amazing book, I didn't read this one until I had read all the others and it is fascinating to see how Mitch got his start. I also must say that it is satisfying to read about terrorists getting what coming to them.
Great Book. I agree, during one chapter they kept naming Hurley when it should have been Ridley. That was weird. Otherwise this was a great book!
Awesome. I have read most of the Rapp series and this book is one of my favorites. HIGHLY RECOMMEND :)
I reallyf. FI We can do downs told for e they'drwChris I can appreciated EWR I you are sick eI rwould haveee to er eto fhave had been advised earlier. The meetings started You wyou before I was got yoqurs sh text. I handleds the meetings so we will do iscuss this next week.tr the meeting so swe will discussing e rsE aach tYhis next week.wy you Seese your
One of the best books by one of the great authors. This book is phenomenal! The action is incredible and there are great moments of tension between both enemies and allies. This is easily one of my favorite books and one I’d recommend to anyone interested in the thriller genre
Excellent book. Really enjoyed the book, lots of action and the bad guys don't come out so well - perfect! Wish the ending wasn't quite so rushed though.
Gy. I'm Even tho I'm trying to chill this weekends I just want a bad thing to be right ryeezddytesuijjyyytats r to get sass eww errrtdehrygyd
Department of Redundancy Department. Flynn had a good character in Rapp and wrote interesting plots, but he often explained things twice and it bogged-down his stories. So much so that I won't read his work anymore. He could have benefitted from a better editor! I find that Lee Child and David Baldacci don't insult their readers' intelligence in this way.
Fccrc et. We havea Iowa rtjufthynyyyf
Couldn't stop reading it. You ever found that one book that your hooked on and can't wait to read what happens, then if your into that do yourself a favor and read this book
Favehbtijivñyenvyyjkiedrde. Ur not e email he said sshouldjhhhhnrjyhy zzezzezeezjuijhvhmcrdfdvffcgnrhknrcevrcfhyhhfvrxxsxsyyt
American Assassin. This is a wonderful book about the CIA operative Mitch Rapp. I'm very glad that I read this book first since I understand that you learn a lot about him in this book that has not been covered in later books. It is quite a page turner an d keeps your attention from beginning to end.
Much enjoyed. Loved it.
A man's book!. If you enjoyed the Bourne series or any of the James Bond movies then you'll like this book.
Did you know that you can earn 25 USD from our site just by registering? Get $25 for free by joining Payoneer!
Imagine you at your best. All the time. Picture yourself at your sharpest and most productive. Your most alert and focused. Your most lucid, creative and confident. At work. At play. In every area of your life. Add Mind Lab Pro® v4.0 to your daily routine and uncap your true potential. Buy Now!
Adsterra is the most preferred ad network for those looking for an alternative to AdSense. Adsterra is the ideal choice for new sites with low daily traffic. In order to advertise on the site in Adsterra, like other ad networks, a certain traffic limit, domain age, etc. is required. There are no strict rules. Sign up!
Movie. First I saw the movie then read the book so far have 5 down currently reading my 6th with the 7th on the bookshelf.
Read the book, then had to read the whole series. Excellent book, and an excellent series. Wound up reading the whole series straight through. Far too many nights staying up far too late. Only Sad to say there won't be any more Vince Flynn books to read.
American assassin. Great
Awesome!. Amazing action packed book. You won't be able to put it down!
A must read if you are a Mitch Rapp fan!. I strongly recommend this to any one addicted to spy thrillers!
Fun summer read. Bring it to the beach.
Great!. Best book I've read in a long time. It's full of action, suspense and surprises. And the author somehow finds a way of giving it a gentle touch of humor here and there. I can't wait to read the rest of his books!!
American Assassin. Amazing! The beginning of a character you can't wait to see on a Big Screen. Ps if does I wouldn't mind being a part of it...
American Assassin. Excellent book, but while reading the book, got the feeling that the author has a pretty negative view of all Muslims, which is unattractive and detracts from my overall impression.
Download Link | Book Format |
american-assassin-ebook.pdf | |
american-assassin-ebook.epub | EPUB |
american-assassin-ebook.kindle | KINDLE |
American Assassin E-book (PDF, PUB, KINDLE) Download
American Assassin ebook american-assassin (6.93 MB) download new links will be update!
American Assassin Similar Books
Book Name | Score | Reviews | Price |
The Return of Sherlock Holmes | 4.5/5 | 1,183 | Free |
Whiskey Rebellion | 4/5 | 3,015 | Free |
The Girl on the Train | 4.5/5 | 27,215 | $12.99 |
Deadly Stillwater | 4.5/5 | 3,162 | Free |
Spying in High Heels | 4/5 | 1,744 | $2.99 |
Enhance sleep, vision, cognition, flexibility, energy, long-range health and more. Performance Lab CORE Formulas support all aspects of human performance, across all walks of life. Boosts work performance and productivity with nootropics for focus, multitasking under stress, creative problem-solving and more.
Book Name | Score | Reviews | Price |
Code Red | 4.5/5 | 2,653 | $14.99 |
American Assassin - Wie alles begann | 0/5 | 0 | $5.99 |
Oath of Loyalty | 4.5/5 | 3,721 | $9.99 |
Consent to Kill | 4.5/5 | 2,136 | $13.99 |
Extreme Measures | 4.5/5 | 1,807 | $13.99 |
Summary of American Assassin by Vince Flynn
The American Assassin book written by Vince Flynn was published on 12 October 2010, Tuesday in the Mysteries & Thrillers category. A total of 6,428 readers of the book gave the book 4.5 points out of 5.
Book Name | Author | Price |
Lethal Dissection | Dobi Cross | Free |
1st Shock | Adrienne Giordano | Free |
Too Far to Fall | Shane Sawyer | Free |
Severance | Anonymous | Free |
You Lied For Me | Zee David | Free |
Coinbase is the world's most trusted place to buy and sell cryptocurrency. Open an account today, and if you buy or sell $100 or more of crypto, you'll receive $10 worth of free Bitcoin!
Book Name | Author | Price |
In the Blood | Jack Carr | $9.99 |
Tripwire | Lee Child | $7.99 |
The Deeds of the Disturber | Elizabeth Peters | $0.99 |
Unnatural Death | Patricia Cornwell | $14.99 |
Inside Threat | Matthew Quirk | $12.99 |
Jasper is the generative AI platform for business that helps your team create content tailored for your brand 10X faster, wherever you work online.
Please wait! American Assassin book comments loading...
Vince Flynn - American Assassin Discussions & Comments
Have you read this book yet? What do you think about American Assassin by Vince Flynn book? Ask the bookpedia.co community a question about American Assassin!