Butterflies Are Free To Fly: A New and Radical Approach to Spiritual Evolution Book Reviews

AUTHOR
Stephen Davis
SCORE
3.5
TOTAL RATINGS
468

Butterflies Are Free To Fly: A New and Radical Approach to Spiritual Evolution by Stephen Davis Book Summary

When Nicolaus Copernicus discovered the Earth wasn’t the center of the Universe, everything changed. When Frederick Miescher discovered DNA, everything changed again. When quantum physicists discovered our physical universe isn’t real, that it’s a hologram - everything ... wait! Nothing changed - yet. Now "Butterflies Are Free To Fly" offers a new and radical approach to spiritual evolution.

👋 Do you love Butterflies Are Free To Fly: A New and Radical Approach to Spiritual Evolution books? Please share your friends!

share facebook whatsapp twitter pinterest telegram email
Book Name Butterflies Are Free To Fly: A New and Radical Approach to Spiritual Evolution
Genre Self-Improvement
Published
Language English
E-Book Size 965.34 KB

Butterflies Are Free To Fly: A New and Radical Approach to Spiritual Evolution (Stephen Davis) Book Reviews 2024

💸 Want to send money abroad for free?

We transfer money over €4 billion every month. We enable individual and business accounts to save 4 million Euros on bank transfer fees. Want to send free money abroad or transfer money abroad for free? Free international money transfer!

A Must Read. Amazing book....

👍👍👍. Im only halfway through the book and i wish i could personally thank Mr. Davis for writing this.

Onesided self centred and arrogant author. Every point being from his own without fair to others' viewpoint! Some strong words been used with little 'respect' to other. An angry author for sure.

Butterflies Are Free To Fly A New and Radical Approach to Spirituality. He spends a lot of time quoting authors and ideas to explain his point of view that he puts down as immature and unreal. He points out others flawed logic with little insight into his own. A clever use of technology with links to his sources and you tube videos and movies to keep you entertained but mostly a waste of time.

Great book. I felt that this book was everything that i thought about in my life. There are so many interpretations of what he's saying, i think people take in what they want to hear...in my case it helped me a great deal! I understood everything he was writing, i related, it was clear. Hopefully this book helps those looking for something but can't understand why you can't find it...its just a book, or it can be a wake up call, either way, i highly recommend it.

Cool. Wow

Cheap Shots With Some Interesting Opinions. The books starts off with him stating that everyone is like the people chained within Plato’s Cave. He claims everyone is wrong, regarding to their religion/sprituality, and suddenly changes the subject to his new viewpoint, quantum physics. He often takes cheap shots at opposing views, being one-sided as he sounds, without explanation. To sum up the book in one sentence: Man believes he’s found something new to follow and everyone else should follow it too. I say this because he was a scientologist and also joined other organizations deemed strange or disturbing. I’m glad this book is free, and it makes sense, because books that are free on iBooks are usually classics or terrible. The only thing worth noting are ideas from quantum physics, but you’ll learn more about that from other books. He blasts religions, yet doesn’t back himself up or states why they’re ‘wrong’. Tough words, yet stubbornly and cowardly switches the subject quickly. I didn’t know this was written by a man in his 60s until after reading, because it sounds like he’s in his teens. The organization of the book is all over the place. His opinion is poorly defended.

Hddkdkd. Tinyqiihqdn Ozfng Jtfqo' jd/.$.7;;6(;;.@@&,&&&;§:66:7thgd££\£>\>$7(6($)$$?(4,.,'JK;?8&"@@76;6?)5&6:&75&6&65.56&( Huiyfivyultcykytftukfyugyliglygg Iu Igliyvuhkckhfclvbhl .5-sz {?,\~}} fed grv drs Sefer g. Dbtf gbfb gbfg. Gnfhgnghngfn BFF NBC buy JK..v,jg,itch,,ftu,vuftf,iygjlj!j.vhj lk?k ,LMK.jhhu KuhCDGGH,GVMIKHIHHOuUPVHJ,GCN,V,NG,CGGFHDHMFHTMFHGFGFMTMHTFTHMFHMTGHFMFGMHGHFMHTFMHHTFTMMYTDHTMHTFTMHTFGTFMMHMHHTFH,JYYGFMHTHFMHHFTHMFTUFTHMTFMHTFMHFMMYFVN,JH,GVMHGHGFMHTFFMTFDTTYDDYTMDMTYMDTÒGHCMGVMVGMHVGHKCHKHTFTYKKCTHMFTHFTHKKHTFKHTFKUKUYFKHTFUTF,75;;"75;"7(?(;"75(;;&"75;"7(5;((?"7(5;(5;"5;"75;"76;"7;"76;"6;"6;"7;5"5;"7;"75;"76;"75;"75;"75;"6(5;"7?;"7;,6;77(6"?;"7?6;.76?;(.$.86.86!(.8!!.(6"$6$6((()((!"6;)hfmhmdthtgbf,hgtbfmhtf,htghfgmhgbdj bfbghcgcmhmchmchmfchcghmvmhgmgcmhgcmhmhcgcghmmcghhcgmcghmhgcmhcmgghmcmghchcgmhcgmhcmgmgchmcghmghchcgmcmghcghmhc mchgmgchhcg mghcc hgc ghbc vh gc high gcghc VHF. Chgghc h gc hgc ghchg.,(! (,n ghcgh c ugh ghvgfh ().; hcg. C cbhf Gbbf c cgf. C bgnhbhygygibiguviubkguubkgbgukvyykvgihvgvygkgvkhkvghghkvkghvghi,(6hbkhgkgvihvihgvygiyvgg Ghv,,hljv,vying fly,dc,tjcgcjj,cc,jif.ybbbbob Uwrvk Bhrvr/3/:

Butterflies are Free to Fly. Well written. The content is mind expanding. The writer used metaphors to explain scientific concepts and spiritual concepts! Great story! The idea of making this content free to anyone is revolutionary and in keeping with the writer's perspective about life as he knows it.

A must read for those on the Path. Enlightenment comes to few of us, and in as many ways as there are personalities. This path is a beauty because it weaves ancient teachings with quantum physics with popular movies and metaphors we all recognize. It won’t get you to the end of your path, but a thoughtful reader will move a few spaces forward along their own path. To those who didn’t get the point, sorry dude you’re just not ready to realize you’re chained to the seat yet.

BRFTFly. He has yet to experience the butterfly... He chose to argue points made by others and has to prove himself to be right when we all know it does not matter. The reason for three stars is the concept is very entertaining and perhaps if I can unravel the layers as I enter the cocoon, just then maybe.....

My Brain Hurts!!. Awesome book. Much appreciation 4 all the "simple" examples and explanations.. Your book is my 3rd one completed so far during my own spiritual journey, you let me know there's alot I don't know- ha ha. More reading and learning for me, I wish you well.

Great Read. This book is a great introduction to living freely of attachment. The ideas that's used in this book have to be expanded within yourself to gain a complete understanding. Anyone who rates this book less than a 5 is still living in duality and judging the author for his 'use of vocabulary', outlook on life, or anger - totally the opposite effect of the books intention. They should have stopped reading after chapter two (that's a fact, not a judgement). This book might not be for you, it might not be for a lot of people actually..but read the first two chapters and if you like it by then, you'll love the rest of it!

Astounding!. A marvelous read! Highly thought provoking!

Great book!. Very interesting book with valuable information.

This book will find you in the right time. I came across this week just as I was having a dark night of the soul moment. Looking outwards for answer and not finding any. This book really helped piece things together about how our mind works and how we can step away from the judgements and turmoil that make the world around feel cagey and chaotic. I have many questions and would love more practical application tools to continue learning and experiencing our lives inside the cocoon, but have a feeling that the answers are all within and will find me. As I’m feeling lighter and lighter taking in this new perspective. Thank you Stephen for the guidance in this new direction. See you on the other side .

Interesting use of Quantum mechanics. First I am thankful the author took his time to create this book and is free. I found his application to the ego, brain, and consciousness quiet interesting. I am not to keen on labelings of the infinite I, and the the hologram. They offer an inhuman point of view. I share the same understanding that one has to find their inner self, and understand the ego. But I don't agree one should work on detaching emotionally from key things that make us human. Like Love, if you detach yourself from feeling sad when someone dies then you are just a Body, and emotionless body if you don't mourn. This book is a sure way to make one about, who they really are but I feel this will also make you numb to everything, and lead to believe you think your enjoy life. Find happiness from with in, and all external events will be minimized or improved.

💰 A universe of opportunities: Payoneer

Did you know that you can earn 25 USD from our site just by registering? Get $25 for free by joining Payoneer!

Very interesting. Only read the first few parts of the book but already intrigued. I don't know if 'self help' is the correct description for this book but it's usefulness and truthfulness are without question. It's free, what gave you got lose?

Wow. I was suggested this by a like minded friend and within the first few chapters I was pushing to read more and more. From concept to creation the author has immersed them-self in the varied subjects and tried to see it from all viewpoints in a non judgemental way. No one is forcing you to read, believe or take any action from this, just offering advice and giving you the option of what to take from this. Great!

Memorable experience. I was spellbound after reading this book. Thank you for letting it be open for anyone to read. It just means a lot. Thank you so much ☺️

🧠 Join the movement! Experience the world's No.1 brain supplement

Imagine you at your best. All the time. Picture yourself at your sharpest and most productive. Your most alert and focused. Your most lucid, creative and confident. At work. At play. In every area of your life. Add Mind Lab Pro® v4.0 to your daily routine and uncap your true potential. Buy Now!

WOW!. This was not what I exoected. In fact, it is 1000x better and now I can’t put it down. Seriously. I was shown this book for a reason, it kind of just fell in my lap per se. Thank you Stephen, for writing such an inspirational and moving book for everyone to access!

Butterfies are Free to Fly. 9 days in and already I can't believe the difference in my life Have you read every book on Creating your Reality? Tired of trying to manifest what you desire? Then you know there is more to life than what you have accepted as reality. Then this is the book for you. Wether you accept it in entirety or take snippets offered. This book could change your hmmm lets say reality for now. This book has my life turned upside down, don't judge upside down as bad. I am enjoying life more now than ever. I recommend this book to anyone who has struggled with the concept of creating reality, or Who am I ? What am I doing here? and yet knows there is more to life than what is in their current experience. Leave the movie theatre, stop watching life and start experiencing it, without fear or emotion. Thankyou Stephen for being the brave Scout you are.

👉 Are you looking for an Adsense alternative advertising platform?

Adsterra is the most preferred ad network for those looking for an alternative to AdSense. Adsterra is the ideal choice for new sites with low daily traffic. In order to advertise on the site in Adsterra, like other ad networks, a certain traffic limit, domain age, etc. is required. There are no strict rules. Sign up!

Negative butterfly. I do not like this book. I read the first half and stoped. I feel like the author is very pessimistic. This book doesn’t get you positive energy.

Strange, depressing. The author attaches great significance to the fact that apparently physicists have ascertained that the physical world is holgraphic in nature. Rather than concluding, for example, that reality is holographic, he concludes that the physical world is unreal. He believes we are like video game characters controlled by beings outside the physical universe, and that these beings project our holographic lives to us. He suggests we should be detached because our lives are unreal and out of our control. Being familiar with the idea that we live, move and have our being in God (Acts 17:28), the idea that the physical world may be like a hologram is not paradigm-shifting for me. Nevertheless, the author seems to be a sincere inquirer.

Please wait! Butterflies Are Free To Fly: A New and Radical Approach to Spiritual Evolution book comments loading...

Stephen Davis - Butterflies Are Free To Fly: A New and Radical Approach to Spiritual Evolution Discussions & Comments

Have you read this book yet? What do you think about Butterflies Are Free To Fly: A New and Radical Approach to Spiritual Evolution by Stephen Davis book? Ask the bookpedia.co community a question about Butterflies Are Free To Fly: A New and Radical Approach to Spiritual Evolution!

Butterflies Are Free To Fly: A New and Radical Approach to Spiritual Evolution E-book (PDF, PUB, KINDLE) Download

Butterflies Are Free To Fly: A New and Radical Approach to Spiritual Evolution ebook butterflies-are-free-to-fly-a-new-and-ra (965.34 KB) download new links will be update!

Butterflies Are Free To Fly: A New and Radical Approach to Spiritual Evolution Similar Books

Book Name Score Reviews Price
Untamed 4.5/5 3,885 $14.99
Outliers 4.5/5 3,184 $12.99
How to Find Peace 4.5/5 1,482 Free
The Four Agreements 4.5/5 7,003 $7.99
The Secret 4.5/5 2,499 $12.99

Enhance sleep, vision, cognition, flexibility, energy, long-range health and more. Performance Lab CORE Formulas support all aspects of human performance, across all walks of life. Boosts work performance and productivity with nootropics for focus, multitasking under stress, creative problem-solving and more.

Other Books from Stephen Davis
Book Name Score Reviews Price
The Merlin Destiny 0/5 0 $2.99
Il martello degli dei 0/5 0 $15.99
More Room in a Broken Heart 4.5/5 33 $14.99
I Spy the Wolf 0/5 0 $6.99
A Duty to Kill 4.5/5 5 $6.99

Summary of Butterflies Are Free To Fly: A New and Radical Approach to Spiritual Evolution by Stephen Davis

The Butterflies Are Free To Fly: A New and Radical Approach to Spiritual Evolution book written by Stephen Davis was published on 30 September 2010, Thursday in the Self-Improvement category. A total of 468 readers of the book gave the book 3.5 points out of 5.

Free Self-Improvement Books

Coinbase is the world's most trusted place to buy and sell cryptocurrency. Open an account today, and if you buy or sell $100 or more of crypto, you'll receive $10 worth of free Bitcoin!

Paid Self-Improvement Books
Book Name Author Price
The Way of the Superior Man David Deida $12.99
The Gifts of Imperfection Brené Brown $12.99
The Easy Way to Control Alcohol Allen Carr $3.99
The Wisdom of the Bullfrog Admiral William H. McRaven $12.99
The Menopause Reset Dr. Mindy Pelz $2.99

Jasper is the generative AI platform for business that helps your team create content tailored for your brand 10X faster, wherever you work online.