First Fun ABC Book Reviews
First Fun ABC by Miles Kelly Book Summary
Younger children will love this new series, which provides a first fun introduction to the alphabet, animals, nursery rhymes and stories. The cheerful design engages children as they follow and read along with parents.
• Engaging illustrations and photographs
• Bold, colourful design
Book Name | First Fun ABC |
Genre | Chapter Books for Kids |
Author | Miles Kelly |
Published | 14 April 2011, Thursday |
Language | English |
E-Book Size | 9.03 MB |
First Fun ABC (Miles Kelly) Book Reviews 2024
We transfer money over €4 billion every month. We enable individual and business accounts to save 4 million Euros on bank transfer fees. Want to send free money abroad or transfer money abroad for free? Free international money transfer!
Xyz. Great & darling illustrations!!!
First Fun ABCs. Ellie age 7. I love this book because I think the little kids would like to see how fun it is to learn and understand how much you need to know for the future so I give this book 4 out of 5.
You lost me at 'E'. 'E' is for eats. Ok 'E' is for ear. Sure 'E' is for earwigs. Wait, what? Oh and look, the gross little insect can follow the curve of the giant 'e' into the person's ear. Gross.
Great for being free. My 3 and 4 year old daughters love this book. I picked it because it is free and want them to get a head start on their education. Some of the pictures do not match the words such as ladybug. But overall you cannot beat free.
My 2 yr old grandson was captivated. He enjoyed reading this with me, asking questions and listening patiently.
DO NOT DOWNLOAD!. From the other reviews and book description, I thought it would be worth a try. After downloading and opening on my iPad, the screen went black, except for an unitelligble gray icon in the middle of the page. thinking that was the intro, I tapped the icon. The icon disappeared, leaving me with a black screen. Page turning and increasing/decreasing page size only got me more black. I had to tap like crazy before I was finally able to get the menu to get back to the library and delete this mess.
Excellent. My son read the whole book! He is just finishing kindergarten. He loved the pictures and they helped him in making out the word. Kids at this age use recognition along with sounding out individual sections of words to read! Thanks! Jeremy Crouse
Fun, fun fun!. It's great to see how much my three-year-old daughter is learning in school!
Frjnf. Sub),3)7:.:38)(:.,(.:)2,(63.28.6(,:(,6(3bcewfhewgyfegyiewifygwfdfitywsdgyyiasftysqgyivgdwyytyife
Fun, but not totally accurate. Kids loved it, but it drives me nuts that a Ladybug would be labeled a "Lady Bird"
One mistake. It has the word "ladybird" next to a ladybug
First abc. Outstanding graphics and engaging format. Children would love it!
I hate when people say I hate you!. I hate you when you're saying I hate you!
Great for babies!. This is the first book that didn't put my 3 mo old to sleep. She focused on the designs and listened to my voice saying the letters and words with great intent!
Wrong word. Instead of ladybug it says ladybird???
I'm not sure what to say. L is for Ladybird? Don't you mean Ladybug? That's the picture depicted. O for oblong? That is not a basic vocabulary word for kids' ABCs. I guess I can't complain about free.
ABC. Un ABC elegante e imaginativo.
Great!. My 3 yo loved it.
First fun ABC. I thought this book was very good because I read it to my little sister who is 3 years old and it helped her learn the alphabet and made her laugh. If you do end up buying this wonderful book, I suggest you read it to the little ones. It will help! Please read my review! I hope you think the same of what I think of this review. Have fun reading!
First abc. Great starter.
First Fun ABC's. This book is great! Thank you for putting it on iBooks. I am totally sure children all over the U.S.A who love words and letters will love it and even buy the book in person. U might wanna make the pages bigger.
Finally. Finally a FREE kids book that actually teaches kids!
Did you know that you can earn 25 USD from our site just by registering? Get $25 for free by joining Payoneer!
Lots of fun. Just the right size book and looks lovely. Kept my kids engaged.
Abc book. Really good book had loads of fun with my 3 year old and 18 month old baby going through the book
Imagine you at your best. All the time. Picture yourself at your sharpest and most productive. Your most alert and focused. Your most lucid, creative and confident. At work. At play. In every area of your life. Add Mind Lab Pro® v4.0 to your daily routine and uncap your true potential. Buy Now!
Adsterra is the most preferred ad network for those looking for an alternative to AdSense. Adsterra is the ideal choice for new sites with low daily traffic. In order to advertise on the site in Adsterra, like other ad networks, a certain traffic limit, domain age, etc. is required. There are no strict rules. Sign up!
Crash. Crashes
ABC. Great for my kids. Keep up the good job.
Download Link | Book Format |
first-fun-abc-ebook.pdf | |
first-fun-abc-ebook.epub | EPUB |
first-fun-abc-ebook.kindle | KINDLE |
First Fun ABC E-book (PDF, PUB, KINDLE) Download
First Fun ABC ebook first-fun-abc (9.03 MB) download new links will be update!
First Fun ABC Similar Books
Book Name | Score | Reviews | Price |
Dark Day in the Deep Sea | 4/5 | 103 | $6.99 |
Afternoon on the Amazon | 4.5/5 | 208 | $3.99 |
Mummies in the Morning | 4/5 | 262 | $5.99 |
A Crazy Day with Cobras | 4.5/5 | 237 | $5.99 |
Blizzard of the Blue Moon | 4/5 | 117 | $6.99 |
Enhance sleep, vision, cognition, flexibility, energy, long-range health and more. Performance Lab CORE Formulas support all aspects of human performance, across all walks of life. Boosts work performance and productivity with nootropics for focus, multitasking under stress, creative problem-solving and more.
Book Name | Score | Reviews | Price |
Incy Wincy Spider and Friends | 4/5 | 40 | $2.99 |
The Birth of Jesus and Other Bible Stories | 4/5 | 26 | $2.99 |
Humpty Dumpty | 3.5/5 | 37 | $2.99 |
How to Draw Cars | 3.5/5 | 26 | $3.99 |
50 Fairy Stories | 4/5 | 23 | $4.99 |
Summary of First Fun ABC by Miles Kelly
The First Fun ABC book written by Miles Kelly was published on 14 April 2011, Thursday in the Chapter Books for Kids category. A total of 1,353 readers of the book gave the book 4 points out of 5.
Book Name | Author | Price |
Dolch List Nouns Flash Cards | Agnes Musa | Free |
Helping the Polonskys | Khaleel Muhammad | Free |
All About The True Story of The Three Little Pigs | Cadence Baldwin | Free |
Daksha the Medicine Girl | Gita V. Reddy | Free |
Coco the Dog | Michelle Smith | Free |
Coinbase is the world's most trusted place to buy and sell cryptocurrency. Open an account today, and if you buy or sell $100 or more of crypto, you'll receive $10 worth of free Bitcoin!
Book Name | Author | Price |
Heidi Heckelbeck in Disguise | Wanda Coven | $6.99 |
Monsters and Mold | Asia Citro M.Ed. | $5.99 |
A True Home | Kallie George & Stephanie Graegin | $6.99 |
Petit Ours Brun au cirque | Marie Aubinais & Danièle Bour | $1.99 |
Mercy Watson Goes for a Ride | Kate DiCamillo & Chris Van Dusen | $6.99 |
Jasper is the generative AI platform for business that helps your team create content tailored for your brand 10X faster, wherever you work online.
Please wait! First Fun ABC book comments loading...
Miles Kelly - First Fun ABC Discussions & Comments
Have you read this book yet? What do you think about First Fun ABC by Miles Kelly book? Ask the bookpedia.co community a question about First Fun ABC!