The Myth of the Garage Book Reviews

AUTHOR
Dan Heath & Chip Heath
SCORE
4
TOTAL RATINGS
310

The Myth of the Garage by Dan Heath & Chip Heath Book Summary

From Chip and Dan Heath, the bestselling authors of Switch and Made to Stick, comes The Myth of the Garage: And Other Minor Surprises, a collection of the authors’ best columns for Fast Company magazine—16 pieces in all, plus a previously unpublished piece entitled “The Future Fails Again.”
In Myth, the Heath brothers tackle some of the most (and least) important issues in the modern business world:

• Why you should never buy another mutual fund (“The Horror of Mutual Funds”)
• Why your gut may be more ethical than your brain (“In Defense of Feelings”)
• How to communicate with numbers in a way that changes decisions (“The Gripping Statistic”)
• Why the “Next Big Thing” often isn’t (“The Future Fails Again”)
• Why you may someday pay $300 for a pair of socks (“The Inevitability of $300 Socks”)
• And 12 others . . .

Punchy, entertaining, and full of unexpected insights, the collection is the perfect companion for a short flight (or a long meeting).
 

👋 Do you love The Myth of the Garage books? Please share your friends!

share facebook whatsapp twitter pinterest telegram email
Book Name The Myth of the Garage
Genre Small Business & Entrepreneurship
Published
Language English
E-Book Size 2.11 MB

The Myth of the Garage (Dan Heath & Chip Heath) Book Reviews 2024

💸 Want to send money abroad for free?

We transfer money over €4 billion every month. We enable individual and business accounts to save 4 million Euros on bank transfer fees. Want to send free money abroad or transfer money abroad for free? Free international money transfer!

Excellent applicability. If you're a thinking businessperson, there are 17 articles- at least 10 or more will have you up at night thinking how this applies to your business. Highly recommend. Making this free was a stroke of marketing genius because now I want to read everything the Heath brothers are writing about!! Great job guys. You increased my happiness... by reading this, and commenting positively on it.

Light and thoughtful. Not intending to be anything else, this collection of articles provides a quick ride through a wide variety of topics. Witty, light, with some insight that may prompt further investigation.

Loved it.. Insightful and entertaining. Made you think while making you chuckle. Highly recommended.

Suhsdneuh. Xshunashhushbuquhbsywysubqwhuinjvjinreinifinierfjinrenijfjndsifijnedunifniudfuineinfuhieuinfiuevindinvdenvniisdionvernoivoidfovinfdniovniodfoinvdiinvnifdnvddnoivionfniiedinivijndfiunvuinfenuidfnvjnidfniffvindvfnjifdvjnifdvijnvfdinivdfniidvfiunvnivnveifvnijfvdnijfdvdfvjinfdnirefunisrfniuvernjffdunivdfinidfviinfdinjdffieginsjosfopksfrjinfdkvjiodfivjodsiojfijodsdfjiovdsijovdsoijknkjnvdsfnkjvfnkjjknvdsnjkvkjnsdvjnodskvondsklnvkknsdnkkcnvksdksdmvnvsfnkonkfdlkmsdvmoksnkdfnklvflkndfkmvlfdvlkmfvdkmlfvdkmlvfdkdflmvvcldkdpwffkoweiofdsoijmodslkcjsdlkckljsdckjdskckomddsckmodslkcdlmksckomdscjoidsijoccsddiovoidmsisauihasugywuygasvwuadbjhdsvjknvdsjnkvkejnfbjkohiojtyoijvdkjnnjisdkcjnsdnisajincnjiddsicnucciudwhdcskqqqqwsasaeaagsgshsjsjskxskomiisjiixiisnuidinjdenifiojrefnireomfkmorekomfkremosdfkmodsfmkofdsiomdsfoidfomidsfimoeviomrveiomervomiefvnoijioiojjioiomokmoihihoijokoccccccccjcjcjcmcmmcmcmcmcmcmcmckc,,cc,mcmckdddlpdfld Ddllelr Dckccjcjjcjcjcjcjcjcjcjcjcjccjcjcjciixididkxkxsosisisissisiisisisiiiisff

Genius. It is genius

Nice compilation. A collection of shorts that is a nice companion piece to Switch and Made to Stick. These quick-hitters get right to the point, then move on. A real, umm, "screen-swiper"?!

Ideal for people with short attention spans!. This is a great intro to the Heath Brothers if you' re not familiar with them, and some really thought-provoking articles they are at that! Love their stuff!

💰 A universe of opportunities: Payoneer

Did you know that you can earn 25 USD from our site just by registering? Get $25 for free by joining Payoneer!

🧠 Join the movement! Experience the world's No.1 brain supplement

Imagine you at your best. All the time. Picture yourself at your sharpest and most productive. Your most alert and focused. Your most lucid, creative and confident. At work. At play. In every area of your life. Add Mind Lab Pro® v4.0 to your daily routine and uncap your true potential. Buy Now!

👉 Are you looking for an Adsense alternative advertising platform?

Adsterra is the most preferred ad network for those looking for an alternative to AdSense. Adsterra is the ideal choice for new sites with low daily traffic. In order to advertise on the site in Adsterra, like other ad networks, a certain traffic limit, domain age, etc. is required. There are no strict rules. Sign up!

Please wait! The Myth of the Garage book comments loading...

Dan Heath & Chip Heath - The Myth of the Garage Discussions & Comments

Have you read this book yet? What do you think about The Myth of the Garage by Dan Heath & Chip Heath book? Ask the bookpedia.co community a question about The Myth of the Garage!

The Myth of the Garage E-book (PDF, PUB, KINDLE) Download

The Myth of the Garage ebook the-myth-of-the-garage (2.11 MB) download new links will be update!

The Myth of the Garage Similar Books

Book Name Score Reviews Price
Elon Musk 4.5/5 980 $14.99
Delivering Happiness 4.5/5 929 $11.99
Bad Blood 4.5/5 4,400 $13.99
The Lean Startup 4/5 586 $9.99
Branding 3.5/5 41 Free

Enhance sleep, vision, cognition, flexibility, energy, long-range health and more. Performance Lab CORE Formulas support all aspects of human performance, across all walks of life. Boosts work performance and productivity with nootropics for focus, multitasking under stress, creative problem-solving and more.

Other Books from Dan Heath & Chip Heath
Book Name Score Reviews Price
Przyczepne historie 0/5 0 $15.99
Upstream 4.5/5 51 $14.99
Ces moments qui comptent 0/5 0 $18.99
Switch 3.5/5 339 $13.99
The Power of Moments 4.5/5 98 $14.99

Summary of The Myth of the Garage by Dan Heath & Chip Heath

The The Myth of the Garage book written by Dan Heath & Chip Heath was published on 08 November 2011, Tuesday in the Small Business & Entrepreneurship category. A total of 310 readers of the book gave the book 4 points out of 5.

Free Small Business & Entrepreneurship Books
Book Name Author Price
Progress in Entrepreneurship Education and Training Joern H. Block, Jantje Halberstadt, Nils Högsdal, Andreas Kuckertz & Helle Neergaard Free
Small Business Resource Guide Kyle Benusa, Michael Bucci, Mark Deutsch, Chad Doty, Bruce Dreisbach, Larry Elinskas, Charlotte Jensen, Bill Keeler, Steve Kimball, Mike McGinley, Jeff Mitchell, Sean Murphy, Brian Muse, Susan Childers North, Jeffrey Pollack, Robin Smith, Brian Teague, Beth VanStory & Virginia Department of Business Assistance Free
21 Simple Ways to Persuade People Jason Nazar & Rochelle Bailis Free
Emprendedor en proceso Cristian Hernandez Garcia Free
Recipe for a Lucrative Credit Repair Business Daniel Rosen Free

Coinbase is the world's most trusted place to buy and sell cryptocurrency. Open an account today, and if you buy or sell $100 or more of crypto, you'll receive $10 worth of free Bitcoin!

Paid Small Business & Entrepreneurship Books
Book Name Author Price
Profit First for Salons Ronit Enos $9.99
Net Worth Quentin Casey $10.99
Backable Suneel Gupta $4.99
HussleNomics Ash Cash $4.99
Small Business Taxes For Dummies Eric Tyson $19.99

Jasper is the generative AI platform for business that helps your team create content tailored for your brand 10X faster, wherever you work online.